Protein Info for ABID97_RS14900 in Variovorax sp. OAS795

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 21 to 179 (159 residues), 78.9 bits, E=2.8e-26
• TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase
  • amino acids 28 to 158 (131 residues), 119.4 bits, E=7.4e-39

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 98% identity to vap:Vapar_2372)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Protein Sequence (274 amino acids)

>ABID97_RS14900 CDP-diacylglycerol--serine O-phosphatidyltransferase (Variovorax sp. OAS795)
MHDDTVPDEVPQRKRRKGIYILPNLFTLAALFGGFYSVVMAMNARFDLAALGVFAAMILD
SLDGRVARMTNTQSAFGEQMDSLSDMVSFGAAPALIAYEWSLKGLGRWGWIAAFVYCACA
ALRLARFNVNTGVVDKRWFQGLPSPAAAALVAGFIWLMTEWGKRGGEVLYLSWTQITWIT
FGFTLYAGLSMVTNAPFYSFKDVQMKKSVPFVVIVLIALGIAVINIHPPTVLFGLFVAYG
LSGYVVYAWRKAKGQPASVISTSTEEPDERGLHN