Protein Info for ABID97_RS14105 in Variovorax sp. OAS795

Annotation: dihydrolipoyllysine-residue acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF00364: Biotin_lipoyl" amino acids 5 to 74 (70 residues), 75.7 bits, see alignment E=6.1e-25 amino acids 119 to 190 (72 residues), 79.9 bits, see alignment E=3e-26 TIGR01348: dihydrolipoyllysine-residue acetyltransferase" amino acids 93 to 559 (467 residues), 641.2 bits, see alignment E=8.1e-197 PF02817: E3_binding" amino acids 251 to 286 (36 residues), 61.5 bits, see alignment 2.2e-20 PF00198: 2-oxoacid_dh" amino acids 333 to 559 (227 residues), 260 bits, see alignment E=5.4e-81

Best Hits

Swiss-Prot: 69% identical to ODP2_CUPNH: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 92% identity to vap:Vapar_2163)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>ABID97_RS14105 dihydrolipoyllysine-residue acetyltransferase (Variovorax sp. OAS795)
MAAVEVKVPDIGDFDEVAVIEVLVKVGDTVKAEQSLITVESDKASMEIPSSTAGVVKEIK
VEVGGKVKEGSVVLLLEAEQAAAAPAPAAAAPAPAAAAPAPAAAAPAPAAAPAASGPVEV
KVPDIGDFKDVAVIELLVKPGDQIAADQSLITVESDKASMEIPSSAAGVLKELKVKVGDT
VNIGDLIAILEGSTAASPSPQPSPQRGEGANPPAAAAAPVSSPAPAGEGRGEGAPAPAPH
EPTAAPTGKLPHASPSVRKFARELGVPLEELKGSGPKGRITQEDVQSFTKAVMSGQASTK
ASAAKAPAGGGADGAALGLIPWPKVDFTKFGTVERKDLSRIKKLSGANLHRNWVMIPHVT
NNDEADITELEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPDFNASLDGDQLVYK
QYFHIGFAADTPNGLVVPVLKDADKKGILQISQEMGELAKKARDGKLGSADMQGGCMSIS
SLGGIGGTHFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGALA
ARFNAYLGQVLADYRRILL