Protein Info for ABID97_RS13960 in Variovorax sp. OAS795

Annotation: VOC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13669: Glyoxalase_4
  • amino acids 14 to 124 (111 residues), 115.8 bits, E=6.2e-38

Best Hits

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 96% identity to vap:Vapar_2133)

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1)" in subsystem Propionyl-CoA to Succinyl-CoA Module (EC 5.1.99.1)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• methylglyoxal degradation I (2/3 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• methylaspartate cycle (12/19 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (10/18 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• ethylmalonyl-CoA pathway (4/11 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5 or 5.1.99.1

Protein Sequence (162 amino acids)

>ABID97_RS13960 VOC family protein (Variovorax sp. OAS795)
MTATARPFKVLGIQQIAIGGPDKLRLQKLWVDMLGLEVTGTFKSERENVDEDICSMGSGP
FKVEVDLMQPLDPDKKPAVHTTPLNHVGLWIDDLPKAVEWLTAQGVRFAPGGIRKGAAGF
DICFLHPKANDEFPIAGEGVLIEMVQAPPEVVAAFGALAATR