Protein Info for ABID97_RS13360 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00005: ABC_tran" amino acids 39 to 180 (142 residues), 111.4 bits, see alignment E=5.6e-36 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 39 to 268 (230 residues), 335.9 bits, see alignment E=6e-105

Best Hits

Swiss-Prot: 55% identical to NRTD_SYNE7: Nitrate import ATP-binding protein NrtD (nrtD) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 74% identity to ajs:Ajs_2833)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>ABID97_RS13360 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MLRPTFSPVSTASTATPGFLRVCGVRQTFSTPKGDFPALSEINLEIRRGEFVALIGHSGC
GKSTLLNLLAGLASPTAGTLSCDGEIIQGPGPRRAMVFQNHSLLPWLSCFDNVRMAVRSV
FRAESASAVDHRTQAALDMVGLTQAAHKKPSEISGGMKQRVGIARALSMEPQVLLMDEPF
GALDALTRAKLQDELLGIVQKTESTVVMVTHDVDEAVLLADRIVMMTNGPAARIGEILDV
PIGRPRDRVSLATDPTYAECRRALMDFLYRRQAHVEQPTG