Protein Info for ABID97_RS12855 in Variovorax sp. OAS795

Annotation: CbbX protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR02880: CbbX protein" amino acids 20 to 295 (276 residues), 504.4 bits, see alignment E=4.3e-156 PF00004: AAA" amino acids 74 to 205 (132 residues), 56.6 bits, see alignment E=7.9e-19 PF07728: AAA_5" amino acids 75 to 141 (67 residues), 24.7 bits, see alignment E=4.2e-09 PF17866: AAA_lid_6" amino acids 208 to 290 (83 residues), 69.7 bits, see alignment E=4.2e-23

Best Hits

Swiss-Prot: 66% identical to CBXXP_CUPNH: Protein CbxX, plasmid (cbxXP) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_3030)

Predicted SEED Role

"probable RuBisCo-expression protein CbbX" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>ABID97_RS12855 CbbX protein (Variovorax sp. OAS795)
MDATETPAAAAVATAPKQLFESSGVKALLDQLDAELIGLAPVKGRIRDIAALLLIDKLRQ
EQGLQSQPPSLHMSFTGNPGTGKTTVAMRMAEVLKQLGYVRKGHLVAVTRDDLVGQFIGH
TAPKTKEVIKKAMGGVLFIDEAYYLYRPENERDYGQESIEILLQVMENQRDDLVVILAGY
KDRMETFFSSNPGMASRIAHHIDFPDYSEAELMQIAQLMLGRLNYSFDDGAATTFSRYVS
LRRGQPHFANARSIRNALDRIRLRHATRLFGSEEALTREQLCTLQAQDILASRVFNLPSE
RAPR