Protein Info for ABID97_RS12660 in Variovorax sp. OAS795

Annotation: formylmethanofuran--tetrahydromethanopterin N-formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01913: FTR" amino acids 9 to 153 (145 residues), 206.4 bits, see alignment E=1.7e-65 TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase" amino acids 15 to 313 (299 residues), 416 bits, see alignment E=4.6e-129 PF02741: FTR_C" amino acids 156 to 313 (158 residues), 196 bits, see alignment E=3.6e-62

Best Hits

Swiss-Prot: 66% identical to FTR_METCA: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ffsA) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 91% identity to vap:Vapar_3065)

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.101

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ABID97_RS12660 formylmethanofuran--tetrahydromethanopterin N-formyltransferase (Variovorax sp. OAS795)
MAAAAGSVQRNGVVIDDTFAEAFPMKATRILVTAHTMEWARHAGVSATGFATSVIACGCE
AGIERELGLHETPDGRPGVSVLIFSMSGKELGKQLERRVGQCVLTCPTTAVFAGLPKGMG
SDVAALGKNLRFFGDGWQISKVIDGVRYWRVPVMDGEFVAEEDTPVVKAVGGGNLLLLAR
DTDGALAAAEAAVAAMKRLRNVVMPFPGGVVRSGSKVGSRYANLSASTNDAFCPSLVGLV
PRSELASGGESAQDIGCVMEIVIDGLTEGDVAAAMRVGMEAAIGIGPAGGLLRISAGNYG
GKLGPFHFHLHKLLGNAGEAP