Protein Info for ABID97_RS12660 in Variovorax sp. OAS795

Annotation: formylmethanofuran--tetrahydromethanopterin N-formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01913: FTR
  • amino acids 9 to 153 (145 residues), 206.4 bits, E=1.7e-65
• TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase
  • amino acids 15 to 313 (299 residues), 416 bits, E=4.6e-129
• PF02741: FTR_C
  • amino acids 156 to 313 (158 residues), 196 bits, E=3.6e-62

Best Hits

Swiss-Prot: 66% identical to FTR_METCA: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ffsA) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 91% identity to vap:Vapar_3065)

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (12/18 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• superpathway of methanogenesis (5/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.101

Protein Sequence (321 amino acids)

>ABID97_RS12660 formylmethanofuran--tetrahydromethanopterin N-formyltransferase (Variovorax sp. OAS795)
MAAAAGSVQRNGVVIDDTFAEAFPMKATRILVTAHTMEWARHAGVSATGFATSVIACGCE
AGIERELGLHETPDGRPGVSVLIFSMSGKELGKQLERRVGQCVLTCPTTAVFAGLPKGMG
SDVAALGKNLRFFGDGWQISKVIDGVRYWRVPVMDGEFVAEEDTPVVKAVGGGNLLLLAR
DTDGALAAAEAAVAAMKRLRNVVMPFPGGVVRSGSKVGSRYANLSASTNDAFCPSLVGLV
PRSELASGGESAQDIGCVMEIVIDGLTEGDVAAAMRVGMEAAIGIGPAGGLLRISAGNYG
GKLGPFHFHLHKLLGNAGEAP