Protein Info for ABID97_RS12615 in Variovorax sp. OAS795

Annotation: DUF6513 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF20123: DUF6513" amino acids 2 to 99 (98 residues), 103.2 bits, see alignment E=3.7e-34

Best Hits

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_3075)

Predicted SEED Role

"Related to Dihydropteroate synthase" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>ABID97_RS12615 DUF6513 domain-containing protein (Variovorax sp. OAS795)
MEHIVFLTGRLAQASLARVLAGIEAAPFTWEVREIGLQVAALMTADMIRRRVAAPVVTEA
QGEGAAPRRADRIMVPGRCRGDVEALSLHFGVPVERGPQELKDLPRHFNRSARAVDLSEY
EVAIFAEIVDAPRRTVPEIIERARQLAADGANVIDLGCLPETRFDHLADSVRALKAEGFQ
VSVDSSDAQELLAGGKAGADYLLSLTLDTLWIADEVDATPVLIPRVPADEDSLYEAVAQM
QRRGRAFLADSILDPIPFGLTASIVRYHRLRERFPDAPIMLGVGNLTELTEADTSGINAV
LFGIAAELNVAAVLTTQVSQHARRAVSEADWARRIMHAAARNATLPKGMSDALMTVHAKH
PFPDTPEEIGEIAAQVRDPNFRVQISPLGLHVYNRDGLRLGQGAFELWPQLKLQDDADHA
FYMGVELARAEIAWQLGKRYVQDQPLDWGCAAPRPAEDLARWCAPGTTMKTPKNNATHAA
EPGAVGAPTAPSPS