Protein Info for ABID97_RS12595 in Variovorax sp. OAS795

Annotation: formaldehyde-activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03126: formaldehyde-activating enzyme
  • amino acids 8 to 166 (159 residues), 246.2 bits, E=7.5e-78
• PF08714: Fae
  • amino acids 9 to 166 (158 residues), 233.1 bits, E=7.8e-74

Best Hits

Swiss-Prot: 69% identical to FAE_METEA: 5,6,7,8-tetrahydromethanopterin hydro-lyase (fae) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K10713, formaldehyde-activating enzyme [EC: 4.3.-.-] (inferred from 99% identity to vap:Vapar_3079)

MetaCyc: 69% identical to formaldehyde-activating enzyme subunit (Methylorubrum extorquens AM1)
RXN-2882 [EC: 4.2.1.147]

Predicted SEED Role

"Formaldehyde activating enzyme" in subsystem Formaldehyde assimilation: Ribulose monophosphate pathway

MetaCyc Pathways

• formaldehyde oxidation VI (H₄MPT pathway) (3/4 steps found)
• superpathway of C1 compounds oxidation to CO₂ (7/12 steps found)

KEGG Metabolic Maps

• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.147 or 4.3.-.-

Protein Sequence (170 amino acids)

>ABID97_RS12595 formaldehyde-activating enzyme (Variovorax sp. OAS795)
MAKIDRLMVGESLVGDGNEVAHIDLIIGPRGSAAETAFANALTNNKDGFTSLLAVVAPNL
LTKPATVMFNKVTIKGAKQAVQMFGPAQRAVALAVADSVEDGTIPMAEADNLFICVGVFI
HWLADDDKKIQDYNYQATRESIQRAVAGLPTAAEVVDKKGTTAHPFAAHL