Protein Info for ABID97_RS12525 in Variovorax sp. OAS795

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 129 to 175 (47 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 19 to 555 (537 residues), 667.8 bits, see alignment E=5.9e-205 PF00664: ABC_membrane" amino acids 24 to 283 (260 residues), 71.4 bits, see alignment E=1e-23 PF00005: ABC_tran" amino acids 349 to 496 (148 residues), 107.1 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 64% identity to ajs:Ajs_0583)

Predicted SEED Role

"type I secretion system ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>ABID97_RS12525 type I secretion system permease/ATPase (Variovorax sp. OAS795)
MKQASFFNRSELTRALWGFRREFLLVGALSCLANLLMLVPTVYMLQIFDRVLSSQSEMTL
LAVSAITLLLFVALALSEWLRSRLLVRASLRFDRQLSTRVFNGSFQAYLGQPASAKSRPF
SDLNHIRQFFTGPGVFALFDAPWAPIYIAVIFFLHPWLGVVSLAFALVQGALAWFGQRRT
VAPAQEVQKAAGDAMSDLQGKLRNIEVLESMGMIANLQRRWNRQHAACMAEGSRAQDVIG
RVAAWSKFIRYSQQSLALAAGALLVIDGQLSPGAMIAANVLMGRALAPIDQLVGTWRSFV
SCRSAFHRLEKLLAEFPAPGHVPSRAAPTGAIGLHGVCVGVPGRATPILKNISFSVPAGT
VVAVLGPSGSGKSTLAKVMVGIWSASAGAVQLDGAPIGAWDRQALGPHLGYLPQDVELFG
GTIAENIARLGEVDSRKVIEAARSAGMHDAILRFPKGYDTPIGDAGGLLSGGQRQRIGLA
RAIYGDPSLIVLDEPNANLDDAGEAALVRALRELKAKGKTVFLVTHRQAAVAVADRLMVL
NDGALAADGPRDVTLAFLRRAQPAVRTAALAQSA