Protein Info for ABID97_RS12375 in Variovorax sp. OAS795

Annotation: phospholipase D family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 93 to 242 (150 residues), 44.2 bits, E=1.7e-15
  • amino acids 345 to 484 (140 residues), 73.7 bits, E=1.3e-24
• PF00614: PLDc
  • amino acids 437 to 462 (26 residues), 23.6 bits, see alignment (E = 4.1e-09)

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_2014)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• cardiolipin biosynthesis II (3/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Protein Sequence (546 amino acids)

>ABID97_RS12375 phospholipase D family protein (Variovorax sp. OAS795)
MSENLTLRISTAATGLRRAVALWLLFALGMLLLGGCAGLPAGVERKPSMAITDSADTLLG
RMVAAASPPGQDLSGFRLLPMPQYSLHARVELARRAQRSIDLQYYLVQNDETGRYLLREL
RNAAERGVRVRLLVDDLYTAGADTLFAGLAAHPNVEVRMFNPFPAGRDRLGTRWTASLFD
FDRVHRRMHNKLFVVDNTMAVMGGRNIANEYFLRDGGSNFIDIDTLVAGTVVPRLSSLFD
MYWNSPYVYPVESLVSMRGATPEQLRARFEQLTGGPDTLHPEPIVSTDLLGNNALAKDLD
EGVLSLAWARAEAYADAPAKALGPTDEARGLPADESTDSVLYNVRRYIRGAQHEVLQTTP
YLIPGRGGMESIRTVRQKGVGYTIVTNSLAATDESLVHIGYRRYRPEMLRLGVELYELSP
KRVEETRRFGMYGSASGRLHGKSAVVDRNIVFIGSMNFDPRSMLHNTEIGIFIFSPQIAQ
QLTSLIGFIRLDGAYQLQLGPRGGIEWVSPASGDGADTILHVEPETDFWARWKLELFAPL
VPESLL