Protein Info for ABID97_RS11870 in Variovorax sp. OAS795

Annotation: inositol-3-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01658: Inos-1-P_synth" amino acids 191 to 299 (109 residues), 122.1 bits, see alignment E=5.7e-40

Best Hits

Swiss-Prot: 62% identical to INO1_MYCS2: Inositol-3-phosphate synthase (ino1) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K01858, myo-inositol-1-phosphate synthase [EC: 5.5.1.4] (inferred from 86% identity to vpe:Varpa_3053)

MetaCyc: 63% identical to inositol-1-phosphate synthase subunit (Mycobacterium tuberculosis H37Rv)
Inositol-3-phosphate synthase. [EC: 5.5.1.4]

Predicted SEED Role

"Inositol-1-phosphate synthase (EC 5.5.1.4)" in subsystem Di-Inositol-Phosphate biosynthesis (EC 5.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>ABID97_RS11870 inositol-3-phosphate synthase (Variovorax sp. OAS795)
MNKIRVAIVGVGNCASSLVQGVQFYGNAEGSDFIPGLMHLDLAGYRPSDIEFSAAFDVHA
HKVGRDLGEAIYAEPNNTIRFADVPRLGVTVQRGPVHDGIGTYLKDVVPLAPGKARNVAK
ILKETRTDVVVSYLPVGSEKATQWYAEQVLEAGCAFVNCVPVFIASRPEWERRFAERGLP
IIGDDIKSQVGATIVHRILTDLFRKRGVRLDRTYQLNFGGNTDFLNMLERERLLSKKISK
TQAVTSQLGHPMKGSDVHVGPSDHVPWLADRKWCYIRMEGTTFGNVPLQCEVKLEVWDSP
NSAGVVIDAVRCAKLAMDRGVGGAVLAPSSYFMKSPPQQFTDDEARELVEAFIRGDAEAA
APPVPRPRMHQPAARHAKGSKLA