Protein Info for ABID97_RS11730 in Variovorax sp. OAS795

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 75 to 279 (205 residues), 222.9 bits, E=2e-70

Best Hits

KEGG orthology group: None (inferred from 60% identity to pna:Pnap_0618)

MetaCyc: 37% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Sphingomonas sp. SKA58)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

No annotation

MetaCyc Pathways

• D-arabinose degradation IV (4/6 steps found)
• L-arabinose degradation V (4/6 steps found)
• D-xylose degradation VI (3/5 steps found)
• L-fucose degradation III (4/8 steps found)
• L-rhamnose degradation III (3/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Protein Sequence (282 amino acids)

>ABID97_RS11730 fumarylacetoacetate hydrolase family protein (Variovorax sp. OAS795)
MKLLSYSHQGQARWGALVGERIADLQAASQGRFPTLPSALSQLGLPGIEALAEGALLDVA
LRDVSLLPVVPDAPRIFCVGLNYEAHRVEAKRERTGQPTIFLRVASSQAGHGQPLVLPSE
SACFDYEGEIAIVIGTGGRRIREEDAWTHVAGYAPYNDGSVRDWQAHTTQWTPGKNFPAT
GGFGPWMVTRGEIADGQVLALTTRLNGETVQHATTEQLIFSMPSLVAYISTFTALEPGDV
IVTGTPGGVGFKRQPPLYMRVGDVVEVEVEGVGTLSNRVCAE