Protein Info for ABID97_RS11665 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 3 to 91 (89 residues), 60.3 bits, see alignment E=2e-20 PF00528: BPD_transp_1" amino acids 114 to 313 (200 residues), 138 bits, see alignment E=3.1e-44

Best Hits

Swiss-Prot: 36% identical to Y209_BRUME: Putative peptide transport system permease protein BMEII0209 (BMEII0209) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 69% identity to rah:Rahaq_2419)

MetaCyc: 39% identical to nickel ABC transporter membrane subunit NikB (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>ABID97_RS11665 ABC transporter permease (Variovorax sp. OAS795)
MSLSYFLKRIGLSVYTLLVVSILVFVITQVLPADPAVMMLGENATPDALQALRDQLGLDA
PLWQQYLHWFTGAIRGDFGESMRTGQAVAPVMMEALGRSLTLAFLSISFMLMIAVPLGII
AAVRRGKIADVLVSVVSYVGVSLPEFVTATLLVLVFADFWQILPATGYIPLSESFSGGLR
HLALPVITVSVILIAHVSRMVRSELVDVLHMDYIRSARLKGLSKHAVLFKHGLRNSLLPT
ITIVALDVGYLLGGVIVVEEIFALPGIGRQLIVAIQNRDLPAIQAGALIMAATYCVVNFV
ADMAYAALDKRIQYE