Protein Info for ABID97_RS11545 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 225 to 252 (28 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 274 (267 residues), 131.1 bits, see alignment E=2.2e-42

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 60% identity to xau:Xaut_0892)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABID97_RS11545 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MADLMQFVFSGLTTGAIYALAALGFSLIYNASGVINFAQGDFLMLGAMITAAMLGANLPY
GLAIAGGVLATVAAGLLLYRLAIKPAGEASVVSLIIITIGASIFIQGVVQIVLGKNQQTL
PPFSGDASLSVLGAYVLPQSLWVLGTAAVLVALCFAFFRFTMIGKAMLAVAANALAARAV
GIPTSRVLQLSFGLSALLGAVAGVVAAPITTTVYDIGLMLGMKGFVAATLGGLGSAGGAV
VGGLIVGLLEALMAGYVSSAYKDAVPFVLIVFILLVMPHGLFGAKTSERV