Protein Info for ABID97_RS11330 in Variovorax sp. OAS795

Annotation: enoyl-CoA hydratase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 12 to 263 (252 residues), 206 bits, E=6.2e-65
• PF16113: ECH_2
  • amino acids 17 to 189 (173 residues), 107.7 bits, E=8.9e-35

Best Hits

KEGG orthology group: K01715, 3-hydroxybutyryl-CoA dehydratase [EC: 4.2.1.55] (inferred from 74% identity to rpc:RPC_0858)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism (EC 4.2.1.55)

MetaCyc Pathways

• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• ethylmalonyl-CoA pathway (4/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.55

Protein Sequence (264 amino acids)

>ABID97_RS11330 enoyl-CoA hydratase-related protein (Variovorax sp. OAS795)
MSYQDIIVEQVEGWLEITIHRPEKMNSLRETTAEEILDALGEAESNREIAAVILRGSDKA
FCTGIDTSEFTIGDNEYFDFYRKRRRSRKVNELFRSLPGYSKPIISAIEGFALGGGLELA
LVGDMIVAGANAKFGLPEIRLGLMPGGGGTQTLPRLIGPALAKELMWTGRRITAAEAREY
RLVNHVTEAGKAIDKARELARTIAGNAPLSVMFTKAVIDRGMDLPLAEGMAAEGDVSFML
YFTQDRQEGLSAFREKRTPDFRGE