Protein Info for ABID97_RS11105 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF00892: EamA" amino acids 16 to 144 (129 residues), 53.3 bits, see alignment E=1.9e-18 amino acids 166 to 302 (137 residues), 59.1 bits, see alignment E=3e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_1867)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>ABID97_RS11105 DMT family transporter (Variovorax sp. OAS795)
MNTAVPASSRLVAYGCLALSMSLVGSYVALSKPLVAAFPVLLLAWLRFGIAALAMPHWLR
RPLAERPMSRRIRGLVFLESFLGNFLFSICMLFGVSLTSAVSAGVIMASIPAVVAVASWL
FLRERITVRIGLAIGCAAIGIGLLALVPAHVQANAEGSSHASMPWLGNLLVFCAVLCESA
YAVIGKSLTGHLGPKRISSLINLWGFVLSMPFGIWFALQFDFSAVRLGTWALLVVYALAA
SIWTVWLWMTGLRHVPAAQAGVFTVMLPVSAALVGVLVLGESLSSAQLIAFALALVGVVL
ATWPERRS