Protein Info for ABID97_RS10990 in Variovorax sp. OAS795

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 188 to 204 (17 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 328 to 352 (25 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details amino acids 395 to 423 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 35 to 395 (361 residues), 248.2 bits, see alignment E=1.2e-77 PF01740: STAS" amino acids 460 to 543 (84 residues), 37.7 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_1844)

Predicted SEED Role

"Sulfate permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>ABID97_RS10990 SulP family inorganic anion transporter (Variovorax sp. OAS795)
MNPASPSPSSSSSLRQRLARWVPCLAWPRPSAALLRNEAMAGITVALMVIPQGVAYAALA
GMPLVTGVYAALFPALIAVIFSSSQRLSVGPTALTSLLVGASLAPLAVPGSSEWVAMAVW
LTLISGAIQIVLGAGRFGWLLRLVNSPVLIGFTQGAAVLIAISQLPALLGFTGRTVPQVL
QGGPPPDFVAIGFGLGSIAVLWLGKRLVPRFPTTMALVAGAAAISWSVNYALRGGAVVGS
LPSGLPSFYWPGLLPSGTFSALVLPALMITLVSFLETASSAKVDNARAGTLWNENQDLIG
QGLAKLASGFTGAFPTSSSFSRSAITLYAGAQTGWATLFSVAVVAGALLWLMPLLYHVPQ
AVLAAVVVTAILGLVKPASFVALWRVSRIEAGISFGTFVLTIATAPSIYWGVLGGLLASM
AHYMYRHLHPRIIEVGLHPDGSLRDRHLWKLPPLAPHLHALRMDAELDFASASTLERALT
VALAERPDLTDVCLFAQPINRIDITGAEVFGSIRRMMETKGVRLHLSGLKLPAMQVLERA
GLLAPGPMLFSYRTDAEALAALAQPEALQRAGTKGSTEADLIS