Protein Info for ABID97_RS10900 in Variovorax sp. OAS795

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03308: MeaB
  • amino acids 2 to 35 (34 residues), 23.9 bits, 2.9e-09
• TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B
  • amino acids 3 to 167 (165 residues), 147.7 bits, E=1.4e-47
• PF03205: MobB
  • amino acids 3 to 125 (123 residues), 159.4 bits, E=7.2e-51
• PF02492: cobW
  • amino acids 3 to 45 (43 residues), 22.2 bits, 1.4e-08

Best Hits

Swiss-Prot: 39% identical to MOBB_ECOLI: Molybdopterin-guanine dinucleotide biosynthesis adapter protein (mobB) from Escherichia coli (strain K12)

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 94% identity to vap:Vapar_1833)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB" in subsystem Molybdenum cofactor biosynthesis

Protein Sequence (181 amino acids)

>ABID97_RS10900 molybdopterin-guanine dinucleotide biosynthesis protein B (Variovorax sp. OAS795)
MKVIGFSGYSGSGKTTLVERLIPVLRLHGQRVSVVKHAHHKFDIDHPGKDTYRHREAGAF
EVVVASDKRLALIREFEQPAQLTVHDLIAELHDGVDWVLVEGFKHSDLLKIEVWRAPEDG
QPPRPSKYIDDAFVTAIATNAPASLPEPTNLPLFDLDDIEGIAQWLIDSGSRFEYNPEHH
G