Protein Info for ABID97_RS10610 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 278 to 294 (17 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 214 (201 residues), 74.1 bits, see alignment E=1e-24 amino acids 216 to 379 (164 residues), 74 bits, see alignment E=1.1e-24 PF12832: MFS_1_like" amino acids 146 to 346 (201 residues), 34.2 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_1776)

Predicted SEED Role

"putative inner membrane efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>ABID97_RS10610 MFS transporter (Variovorax sp. OAS795)
MKGSELLRVIGAQVCLHATMAGMRLATPLLALQQGYSAAAVGVLISLFALTQVFLALPAG
RFADRHGFKRPLWLSVIAASAGAGLVVVFPVFPAMCVAALLTGGATGATVIALQRHVGRS
ATNATQLKRVFSWLAIAPAVANFVGPFVAGMLIDHAGRVPADMLAFRVCFAVMAAFPILC
WLFARSAHEPPPTETAAGAAGTRAWDLLREPMFRRLLFVNWLQSSSWDVHAFVLPVLGHD
RGISASVIGSILGAFAIAAAVIRVVLPLVASRASERSVILVSTLVTAGVFAVYPLLDSAW
TMALCSVILGFALGAVQPMVMSMLHQITPHTRHGEALGLRLMTINASSVAMPMLFGSLGA
LIGIAGVFWVVGGVVALGARATWGLKAPL