Protein Info for ABID97_RS10595 in Variovorax sp. OAS795

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 324 to 354 (31 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 400 to 424 (25 residues), see Phobius details amino acids 446 to 469 (24 residues), see Phobius details PF16980: CitMHS_2" amino acids 30 to 469 (440 residues), 671.6 bits, see alignment E=5e-206

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_1773)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>ABID97_RS10595 sodium:proton antiporter (Variovorax sp. OAS795)
MKKIVRLAAAAVLPMMFPALAMAASLDGSRLSAPWGIPFAGLLLSIALMPLLAPSVWHHH
YGKISAAWALAFLLPFAVIHGVPLAGSQLVHALVEEYIPFIILLTALFTVAGGIHIRGNL
HGAPGLNTAILAIGAVLASLMGTTGASMLLIRPLVRANDNRVSKAHVVVFFIFIVSNAGG
SLTPLGDPPLFLGFLKGVDFFWTARNILPETLFLVGMLLALFYVIDRYHYRKEGVLPFDP
TPDTRRVGFDGAANFWLLGGVVFLVLLSGLWKSPVGFEVFGTRVGLPGLVRDVGLVAITL
VSFKTTAPKVHADNQFEWGPMAEVAKLFAGIFLTIIPVIAMLKAGAHGPFAAVIAAVTKP
DGQPDPAMYFWASGILSSFLDNAPTYLVFFNTAGGDPVALMTTYATTLAAISAGSVFMGA
NSYIGNAPNLMVKAIAESRGVRMPSFFGYMGWSVAILIPLFVLSTFIFFR