Protein Info for ABID97_RS10425 in Variovorax sp. OAS795

Annotation: HlyD family efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF25881: HH_YBHG" amino acids 76 to 205 (130 residues), 49.8 bits, see alignment E=6.1e-17 PF25954: Beta-barrel_RND_2" amino acids 245 to 329 (85 residues), 34.9 bits, see alignment E=2.2e-12 PF25990: Beta-barrel_YknX" amino acids 246 to 326 (81 residues), 36.4 bits, see alignment E=8.1e-13

Best Hits

Swiss-Prot: 41% identical to YBHG_SALG2: UPF0194 membrane protein YbhG (ybhG) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 91% identity to vap:Vapar_1741)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABID97_RS10425 HlyD family efflux transporter periplasmic adaptor subunit (Variovorax sp. OAS795)
MNKKPLIAAAVLVLAAAAGGWWYAHRSAEPSSQLVLYGNVDLRQVSLAFNANERVAELAV
REGDRVRAGQLLGRLDTRSLALRVAQSQARIGVQEQALLRLKTGSRPEELAQAGAQVAAA
QADADLAQQQLARLQSIGQTTAGRAVSQQDLDSAQARRKVALAQLDNVRRAQQLAVAGPR
KEDIAQAQAQLESARADLALMNHQLAEAELKAPIDAVVRARLLEPGDMASPQRPAFTLAI
TDPKWVRAYVAEPDLGRVQPGQEARVTTDSQPGQPIMGKVGYISSVAEFTPKTVQTEELR
SSLVYEIRVMVDDREDRLRLGMPATVRLQLAAPASTGKP