Protein Info for ABID97_RS10415 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 12 to 313 (302 residues), 59.6 bits, see alignment E=6.3e-20 PF12698: ABC2_membrane_3" amino acids 27 to 370 (344 residues), 179.1 bits, see alignment E=2.8e-56 PF12730: ABC2_membrane_4" amino acids 169 to 303 (135 residues), 36.4 bits, see alignment E=1e-12 PF01061: ABC2_membrane" amino acids 174 to 340 (167 residues), 82.7 bits, see alignment E=5.8e-27

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 92% identity to vpe:Varpa_1910)

Predicted SEED Role

"ABC transport system, permease component YbhS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>ABID97_RS10415 ABC transporter permease (Variovorax sp. OAS795)
MNAKFWLRLVSLTRKEFRQLLRDRSNLAIGILLPMVLILIFGYGMSLDVKNAPVGVVLED
PSPTAHEAIAGLQLSPTIAPVLLASMHDAEALMRERKIDGIVRVPSDFSRSLAAGNARVQ
LIVHGADAGRASIIQAYVSGALAQAAVRRADRGGRAGGADAPATGRVTVEQRMWFNAANT
STWYLVPGLIVLIMTLVGAFLTALVMAREWERGTLEALFVTPVRPVEILLAKIIPYFAVG
MLGLALCLLAARFLFAVPMHGSLLVVVLSSMLYLIVAVSLGLVISSVTRNQFLASQVALI
ATFMPSMMLSGFLFDLRNVPTAVRVIGHVLPATYFMDLIKTLFLAGDVWPLIWRNCAILT
AYAVGLLLLARAVTRKSLD