Protein Info for ABID97_RS10265 in Variovorax sp. OAS795

Annotation: YeaH/YhbH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF04285: DUF444" amino acids 6 to 426 (421 residues), 588.7 bits, see alignment E=3.6e-181

Best Hits

Swiss-Prot: 55% identical to Y1873_VIBCH: UPF0229 protein VC_1873 (VC_1873) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K09786, hypothetical protein (inferred from 96% identity to vap:Vapar_1709)

Predicted SEED Role

"FIG002076: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>ABID97_RS10265 YeaH/YhbH family protein (Variovorax sp. OAS795)
MAILQQIIDRRLSGKNKSIGNRERFLRRYKGQIQEAVRRAVSGRNIRELEQGEDVTLPRH
DVSEPVFGHARGGDREYVHPGNQEYLKGDRIARPEGQAGGGSGSGEAGDGGEGEDDFVFR
LTREEFMRVFFDDLALPHLIRTQIAEVPEWKSHRAGFTSDGSPNNLHVVRSMRGALARRI
ALGGEPRKELKRLEAHLLHLQSHPQATQGLIKNEIRETEERIEEMRRTMRHVPYIDPIDL
RYRNRVKTPVPSAKAVMFCLMDVSGSMDEARKDMAKRFFMLLYMFLTRHYERIDLVFLRH
HTQAQEVTEEEFFHATETGGTVVSSALVLMDEIIKARYPSGEWNVYGAQASDGDNWHQDS
GRCRELLVDHILPVVRYYAYVQVAETEQNLWQEYAQLQGIQPNFAMRKVSDARDIYPVFR
DLFKKEGVPA