Protein Info for ABID97_RS10055 in Variovorax sp. OAS795

Annotation: nitrile hydratase accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF21006: NHase_beta_N" amino acids 18 to 100 (83 residues), 44.4 bits, see alignment E=8.4e-16 TIGR03889: nitrile hydratase accessory protein" amino acids 23 to 94 (72 residues), 102.3 bits, see alignment E=5.5e-34

Best Hits

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_1667)

Predicted SEED Role

"putative metal chaperone, involved in Fe-nitrile hydratase activation, GTPase of COG0523 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>ABID97_RS10055 nitrile hydratase accessory protein (Variovorax sp. OAS795)
MRTDLPPLALAPGMPRDADGPVFREPWEAQAFAMTLALHERGLFTWVEWAEALAAQIAAA
QAAGDPDAGDTYYRHWLAALEGLVARKGASSGDELARYRYAWDHAADRTPHGQPIELRRE
DFSF