Protein Info for ABID97_RS09945 in Variovorax sp. OAS795

Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 TIGR01818: nitrogen regulation protein NR(I)" amino acids 4 to 400 (397 residues), 621.4 bits, see alignment E=5.1e-191 PF00072: Response_reg" amino acids 4 to 119 (116 residues), 82.9 bits, see alignment E=5.7e-27 PF00158: Sigma54_activat" amino acids 143 to 308 (166 residues), 236.7 bits, see alignment E=3.5e-74 PF14532: Sigma54_activ_2" amino acids 143 to 313 (171 residues), 72.8 bits, see alignment E=1.1e-23 PF07728: AAA_5" amino acids 166 to 284 (119 residues), 37 bits, see alignment E=9.7e-13 PF25601: AAA_lid_14" amino acids 314 to 397 (84 residues), 85.6 bits, see alignment E=5.1e-28 PF02954: HTH_8" amino acids 467 to 505 (39 residues), 40.8 bits, see alignment 4.4e-14

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 94% identity to vap:Vapar_1635)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>ABID97_RS09945 nitrogen regulation protein NR(I) (Variovorax sp. OAS795)
MKPIWIVDDDQSIRFVLEKALLREDLPTRSFTNTREVLAALELAEDDDQQGPQVLVSDIR
MPGGSGLDLLDKIKAKHPGLPVIIMTAFSDLDSAVSAFQGGAFEYLPKPFDLPRAVELIR
RAVDESQREEVAEERMVAAPEMLGQAPAMQDVFRAIGRLSQSNVTVLITGESGSGKELVA
RALHKHSPRANGPFVAINTAAIPKDLLESELFGHERGAFTGAQTMRRGRFEQAEGGTLFL
DEIGDMPFDLQTRLLRVLSDGHFYRVGGHNSVKANVRVIAATHQDLEQRVKLGGFREDLF
HRLNVIRLRLPALRERGEDVPALTRHFLQVSARQLGVEPKRISDAALARLAAFGFPGNVR
QLENICHWLTVMAPAQLIEAKDLPPEVMAAAAGAQAQAADATGAAMPVQAAPQFSPSSPE
RETLPAGAPSEPAEGLVGASSWESGLEVEAQALLAAGRTDVWDVLSRRFESRLILTALAN
TRGRRIEAAQKLGIGRNTITRKIQELGIE