Protein Info for ABID97_RS09520 in Variovorax sp. OAS795

Annotation: 3-phosphoserine/phosphohydroxythreonine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01364: phosphoserine transaminase" amino acids 1 to 354 (354 residues), 459.1 bits, see alignment E=4.6e-142 PF00266: Aminotran_5" amino acids 2 to 343 (342 residues), 135.2 bits, see alignment E=1.5e-43

Best Hits

Swiss-Prot: 74% identical to SERC_POLSJ: Phosphoserine aminotransferase (serC) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 94% identity to vap:Vapar_1618)

MetaCyc: 44% identical to phosphoserine transaminase (Trichomonas vaginalis)
Phosphoserine transaminase. [EC: 2.6.1.52]

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>ABID97_RS09520 3-phosphoserine/phosphohydroxythreonine transaminase (Variovorax sp. OAS795)
MPEAVLQRAASDMLDWQGSGMSVMEMSHRGKEFGAICTQAEADIRTLLAVPDHFHILFMQ
GGGLGENAIVPMNLSRGKSADFVITGSWSIKSQKEAQRYCTANIAASNAADHHTRLPDPS
TWRLTQDASYVHLCTNETINGIEFQQLPDLAALGSKAPLVIDFSSHVASRSIDWRRVGLA
FGGAQKNLGPAGLTLVIVRDDLLGHALEICPSAFNYKIVADNQSMYNTPPTWGIYIAGLT
FQWLLQQTEGTLTGVAAMEQRNIAKARLLYDFIDASSFYANRIDPACRSRMNVPFFLEDE
SRNDAFLAGAREAGLLQLKGHKSVGGMRASIYNAMPLEGVQALVGYMREFERSHA