Protein Info for ABID97_RS09520 in Variovorax sp. OAS795

Annotation: 3-phosphoserine/phosphohydroxythreonine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01364: phosphoserine transaminase
  • amino acids 1 to 354 (354 residues), 459.1 bits, E=4.6e-142
• PF00266: Aminotran_5
  • amino acids 2 to 343 (342 residues), 133.2 bits, E=6.1e-43

Best Hits

Swiss-Prot: 74% identical to SERC_POLSJ: Phosphoserine aminotransferase (serC) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 94% identity to vap:Vapar_1618)

MetaCyc: 44% identical to phosphoserine transaminase (Trichomonas vaginalis)
Phosphoserine transaminase. [EC: 2.6.1.52]

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Protein Sequence (355 amino acids)

>ABID97_RS09520 3-phosphoserine/phosphohydroxythreonine transaminase (Variovorax sp. OAS795)
MPEAVLQRAASDMLDWQGSGMSVMEMSHRGKEFGAICTQAEADIRTLLAVPDHFHILFMQ
GGGLGENAIVPMNLSRGKSADFVITGSWSIKSQKEAQRYCTANIAASNAADHHTRLPDPS
TWRLTQDASYVHLCTNETINGIEFQQLPDLAALGSKAPLVIDFSSHVASRSIDWRRVGLA
FGGAQKNLGPAGLTLVIVRDDLLGHALEICPSAFNYKIVADNQSMYNTPPTWGIYIAGLT
FQWLLQQTEGTLTGVAAMEQRNIAKARLLYDFIDASSFYANRIDPACRSRMNVPFFLEDE
SRNDAFLAGAREAGLLQLKGHKSVGGMRASIYNAMPLEGVQALVGYMREFERSHA