Protein Info for ABID97_RS09410 in Variovorax sp. OAS795

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF13401: AAA_22" amino acids 35 to 149 (115 residues), 28 bits, see alignment E=6e-10 PF13191: AAA_16" amino acids 36 to 150 (115 residues), 32.8 bits, see alignment E=2.4e-11 PF07728: AAA_5" amino acids 37 to 188 (152 residues), 58.3 bits, see alignment E=2.2e-19 PF00004: AAA" amino acids 38 to 189 (152 residues), 35.9 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to vpe:Varpa_1758)

MetaCyc: 50% identical to CoxD sulfurtransferase monomer (Afipia carboxidovorans)
RXN-21549

Predicted SEED Role

"carbon monoxide dehydrogenase D protein" in subsystem CO Dehydrogenase or Carbon monoxide dehydrogenase maturation factors

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABID97_RS09410 MoxR family ATPase (Variovorax sp. OAS795)
MIFPTIDSLSAGLVQAGYFADRRLATAVFLALKLQRPLLLEGEPGVGKTELAKALSTALN
RELLRLQCYDGLEQREALYEWNYAAQLLHMRAAEATGAARDVEAEVYQPHYLIRRPLLQA
LQTPAPGAVLLIDEVDRADEPFEAFLLEYLGEYQVSIPELGTVRAVVPPVTILTSNRTRE
LNDAVKRRCLYHWLDYPERERELAIVRAQVPEAGEKLSAQVAAFVARLRDAPFVNAFQRA
PGIAESVEWARALIALDTVELDPEVVVDTAGILFKQRDDVAALTRDLATDLLKPEEPVAP