Protein Info for ABID97_RS09280 in Variovorax sp. OAS795

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 6 to 276 (271 residues), 402 bits, E=3.2e-124
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 8 to 611 (604 residues), 871.9 bits, E=1.3e-266
• PF00456: Transketolase_N
  • amino acids 24 to 180 (157 residues), 22.9 bits, E=9.8e-09
• PF00676: E1_dh
  • amino acids 112 to 182 (71 residues), 35.5 bits, E=1.5e-12
• PF02779: Transket_pyr
  • amino acids 313 to 473 (161 residues), 160.3 bits, E=9.7e-51
• PF02780: Transketolase_C
  • amino acids 489 to 605 (117 residues), 101.7 bits, E=6.8e-33

Best Hits

Swiss-Prot: 84% identical to DXS_ACIAC: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 96% identity to vap:Vapar_1571)

MetaCyc: 59% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (627 amino acids)

>ABID97_RS09280 1-deoxy-D-xylulose-5-phosphate synthase (Variovorax sp. OAS795)
MAALLPTLHDPSPIRHYDRAQLKQLSDEVRACVLDNVSRTGGHLSSNLGTVELTVALHHV
FNTPHDRLVWDVGHQTYPHKILTGRRERMPTLRQIGGISGFPQRSESEYDTFGTAHSSTS
ISAALGMAMAAKQKGEDRHTVAIIGDGALTAGMAFEALNNAGVCDCKLLVILNDNDMSIS
PPVGALNRYLAQLMSGNFYAAAKNVGKSVLRAAPPLFELAKRFEQHAKGMVVPATLFEQF
GFNYVGPIDGHDIDSLVPTLENLKHLDGPQFLHVVTRKGQGYKLAEADPVAYHGPGKFDP
QVGLVKPAAVPKQTFTQVFGQWLCDMAAHDGRLVGITPAMREGSGLVEFEQRFPGRYYDV
GIAEQHAVTFAAGLACEGLKPVVAIYSTFLQRAYDQLIHDVAIQNLPVVFALDRAGLVGA
DGATHAGAYDIPFLRCIPNMSIACPADERECRQLLSSAYAQNHPVAVRYPRGAGAGVTPH
LALDALPFGKGEVRREGKRIAILAFGTLLYPALAAAESLDATVVNMRWAKPLDVELLLQV
AGAHDAIVTVEEGATMGGAGSAVLEALQAAQVHKPVLQLGLPDRFIEHGDPAKLLASIGL
DAAGIEQSVTQRFGAALSAGKTPPGAM