Protein Info for ABID97_RS09055 in Variovorax sp. OAS795

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details PF01478: Peptidase_A24" amino acids 23 to 125 (103 residues), 71 bits, see alignment E=5.4e-24

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 78% identity to vap:Vapar_1517)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>ABID97_RS09055 prepilin peptidase (Variovorax sp. OAS795)
MREFDAFLELLLMLATDLRMCGLLVLLVIAAVSDWRFYRIPNWLTFGGMAFAVVYGTIAA
RTPMAGLTQALGGLATGLVILLPFYALGIMGAGDVKLMAMVGAFIGPYQTLWAILFTCIA
GGAAAVIFAMHRRRLGHMLTNVKDTVHGMAMSGMSGFRPNGTIDTRQSIGKLPYGICICA
GTVAEVLAHQLGYV