Protein Info for ABID97_RS08700 in Variovorax sp. OAS795

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase
  • amino acids 9 to 336 (328 residues), 438.9 bits, E=6.1e-136
• PF00586: AIRS
  • amino acids 61 to 166 (106 residues), 83.1 bits, E=2e-27
• PF02769: AIRS_C
  • amino acids 178 to 342 (165 residues), 115.4 bits, E=2.8e-37

Best Hits

Swiss-Prot: 88% identical to PUR5_POLSJ: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 97% identity to vap:Vapar_1465)

MetaCyc: 58% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Protein Sequence (346 amino acids)

>ABID97_RS08700 phosphoribosylformylglycinamidine cyclo-ligase (Variovorax sp. OAS795)
MTSPTPTPLSYKDAGVDIDAGDALVDRIKPLAKKTLREGVLAGIGGFGALFEVPKRYKEP
VLVSGTDGVGTKLKLAFEWNMHDTVGIDLVAMSVNDVLVQGAEPLFFLDYFACGKLDVDT
AAAVIGGIARGCEISGCALIGGETAEMPGMYPAGEYDLAGFAVGAVEKSKILTGQNVKPG
DVVLGLASAGVHSNGFSLVRKVIERAGSDLPATLDGKPFREAVMEPTHLYVKPVLEALAR
HPIKALAHITGGGLLENIPRVLPEGTAAHLKKGSWPQTELFAWLQKVAGIDDIEMNRTFN
NGIGMVVVIDASEAAACAATLRAAGESVFEIGTIAERGAGAAVIVG