Protein Info for ABID97_RS08600 in Variovorax sp. OAS795

Annotation: kynureninase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR01814: kynureninase" amino acids 7 to 412 (406 residues), 313.3 bits, see alignment E=1.2e-97 PF00266: Aminotran_5" amino acids 78 to 296 (219 residues), 55.8 bits, see alignment E=4.1e-19 PF22580: KYNU_C" amino acids 312 to 407 (96 residues), 119.7 bits, see alignment E=4.4e-39

Best Hits

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 92% identity to vap:Vapar_1448)

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>ABID97_RS08600 kynureninase (Variovorax sp. OAS795)
MTTLDDCRALDAQDPLRALRDQFTLPKGVIYLDGNSLGVLPKAAPARIAEVVAEEWGRGL
IRSWNTASWFDLPQRLGDKLARLIGAAPGEVVCTDSTSVNLYKVLFAALSQQKDSGRKLV
VSERSNFPTDLYIAESLCRERGFTLKLIEAGELQGPGSVLTDEVAVLMLTHVNYRTGAMH
DMKAITAAAHAAGALTVWDLAHSAGAVPVALNESNADYAIGCGYKYLNGGPGAPAFVWVH
ARHAGKFEQPLSGWWGHAAPFEFTPHYRPAPGVGRYLCGTQPIISLAGLECGLDTVLAAE
AFDDGRGAMAALRAKSLALTDLFIRLVEERCAGQGLSLVTPREHAQRGSQVCLGRGEGAY
PIVQALIARGVIGDYRAGDSQMPDILRFGFTPLYLGFEDVWNSVEHLVQVLESGEWKREE
FNRKNAVT