Protein Info for ABID97_RS08440 in Variovorax sp. OAS795

Annotation: tRNA pseudouridine(38-40) synthase TruA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 3 to 241 (239 residues), 197.2 bits, see alignment E=1.6e-62 PF01416: PseudoU_synth_1" amino acids 8 to 101 (94 residues), 45.3 bits, see alignment E=5.5e-16 amino acids 142 to 248 (107 residues), 95.4 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 96% identical to TRUA_VARPS: tRNA pseudouridine synthase A (truA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 96% identity to vap:Vapar_1417)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABID97_RS08440 tRNA pseudouridine(38-40) synthase TruA (Variovorax sp. OAS795)
MRLALGIRYNGQAYEGWQSQRSGRTVQDKLEAALARFADQPIGTLCAGRTDAGVHALMQV
VHFDTGVEREPFSWMRGTNRYLPDDIAVQWAHPVPGEFHCRASALARRYLYVLSQSPVRP
SLDSGRVGWSMHALDGDAMRAAAALLVGQHDFSSFRASACQARSPVKDLRRIEITRVGAG
DRCRWHFEFEADAFLHHMIRNLMGCLVRIGRGDERPEWIAEVLEARSRKVAAPTFSASGL
YFLGPLYDAKWGLPAEATLQAGGAPYDGPP