Protein Info for ABID97_RS08365 in Variovorax sp. OAS795

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR02191: ribonuclease III" amino acids 8 to 221 (214 residues), 216 bits, see alignment E=2.3e-68 PF14622: Ribonucleas_3_3" amino acids 18 to 138 (121 residues), 127.5 bits, see alignment E=7.5e-41 PF00636: Ribonuclease_3" amino acids 37 to 127 (91 residues), 83.7 bits, see alignment E=2.9e-27 PF00035: dsrm" amino acids 155 to 220 (66 residues), 36.6 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 99% identical to RNC_VARPS: Ribonuclease 3 (rnc) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 99% identity to vap:Vapar_1402)

MetaCyc: 48% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABID97_RS08365 ribonuclease III (Variovorax sp. OAS795)
MDGGLPALQERLKHSFSDPRLLQLALTHRSFSADHNERLEFLGDSVLNLAVSHLLYTRLS
ALPEGDLSRVRANLVKQDTLHRLALELQLSPLLRLGEGEARSGGPNRPSILADALEALIG
AVYLDAGFLAAEALVRRLYESVEINPRMDAVAKDPKTELQEWLQGHKMKLPVYRVAATLG
AAHKQTFDVECEVPELGLRERGIGGSRRAGEQAAAAAMLIRLKARGAA