Protein Info for ABID97_RS08305 in Variovorax sp. OAS795

Annotation: ACP S-malonyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00128: malonyl CoA-acyl carrier protein transacylase
  • amino acids 3 to 296 (294 residues), 317.7 bits, E=4.1e-99
• PF00698: Acyl_transf_1
  • amino acids 6 to 291 (286 residues), 113.3 bits, E=8.6e-37

Best Hits

Swiss-Prot: 51% identical to FABD_ECOL6: Malonyl CoA-acyl carrier protein transacylase (fabD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 94% identity to vap:Vapar_1390)

MetaCyc: 51% identical to [acyl-carrier-protein] S-malonyltransferase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-malonyltransferase. [EC: 2.3.1.39]

Predicted SEED Role

"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• fatty acid biosynthesis initiation (plant mitochondria) (1/4 steps found)
• mycobactin biosynthesis (3/11 steps found)
• pederin biosynthesis (2/14 steps found)
• bryostatin biosynthesis (2/19 steps found)
• mupirocin biosynthesis (1/26 steps found)
• corallopyronin A biosynthesis (2/30 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Protein Sequence (317 amino acids)

>ABID97_RS08305 ACP S-malonyltransferase (Variovorax sp. OAS795)
MKSFAFVFPGQGSQAVGMLDAWGDHPAVAETLREASEALGEDVAALIKNGPKEELALTTN
TQPVMLVAGVAAWRAWLAEGGAAPSVVAGHSLGEYSALVASGVLTLAQAAPLVRFRARAM
QQAVPVGVGAMAAVLGMDSAKVVAGCAEATASFGAGSAEIVEAVNFNDPMQTVIAGSKAA
VDKACELLKAHGAKRALLLPVSAPFHSSLMKPAAEALREKLTTVSFAAPQIPVLNNIDVA
VETDPERIRDALVRQAAGPVRWVESMQALKLRGIASIIECGPGKVLAGMVKRIAPDLEAA
SVYDPATLADTRQLLAG