Protein Info for ABID97_RS08270 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 320 (306 residues), 64.6 bits, see alignment E=4.1e-22

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_1383)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>ABID97_RS08270 MFS transporter (Variovorax sp. OAS795)
MAATASTRWAARAQFFASGFIFATWGVHVPTVKAHYGIDEAQLGLAMLAAGAGAMLGLTS
AGRWIGRHGARRMAALCGCIYALLLAGLIAMPGYLFLLALLAVFGLVTSVFDVAINAEAA
QLELLGGQPLMSGMHGMFSLGGMAGAASGSAALAAGLGPQAHLLWVAAAMVLMVAVSSWH
MLPQPPAASDASAADHSFRLPRGVLAVLGVLAALGLIAEGAIYDWSVLYMQQELGSPQNQ
AALAYASFSAAMAAARFGGDAMRARFSPAALLLGSGVLAAAAMTLVLLTDLPWLALVGFA
GVGVGFANVVPILFGASARVPGVEPATGIAAVSAVAYLGFMAGPAVIGLLARAASLTAAL
YVVVVFAVALAASARYTDTGARP