Protein Info for ABID97_RS08205 in Variovorax sp. OAS795

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 304 to 334 (31 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details PF01594: AI-2E_transport" amino acids 74 to 409 (336 residues), 185.7 bits, see alignment E=7.4e-59

Best Hits

KEGG orthology group: None (inferred from 78% identity to vap:Vapar_1364)

Predicted SEED Role

"FIG00931248: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>ABID97_RS08205 AI-2E family transporter (Variovorax sp. OAS795)
MSDDKNPGGQAVADKAASQPVEPPPELPPEPVTEPLPEAAAPPETKPEPEPEPDRVLLHM
PVDVRSASLVVLAVLASVFALRWASAVFIPLMLSLLLSYALSPLVDVLENWKVPRWIGAA
VILLGLGGGLGWTGYSLSGSASELLDALPVAAQKLRQAARSDRNAAATPLDSVQQAAAQL
ERAAEENSARVAARKGVARVVIERPPFNVREYLWSGTVGLLSAMGQLTLVAFLTFFALCS
GNTFRRKLIKITGPSLQKKKITVHVLDDITKNIERYLLVQILTSILVGVATGLAFWFLGL
DNAAVWGIVAAVTNLMPYIGSVIVMAAAGLVAFVQFNTIEMGLLVAGTSLVIHTLVGNLL
VPWLTSRTSRMNPVAVFVGVIFWGWLWGVWGLLLGIPITMVIKSICDRVEDLQPIGELLG
E