Protein Info for ABID97_RS08055 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 107 to 123 (17 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details PF07690: MFS_1" amino acids 55 to 373 (319 residues), 74.3 bits, see alignment E=4.3e-25

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 93% identity to vap:Vapar_1341)

Predicted SEED Role

"cyanate transport system protein CynX, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>ABID97_RS08055 MFS transporter (Variovorax sp. OAS795)
MSALPLRASHAADDLLIDAEADSLPAPRATPAGSLGRRILLGASVVLIAFNLRPVFASLS
VVLPEIIAATGLSATAASLLTTLPIVCLGVFAPLAPGLGRRFGTERTLLGCMVLILVGTL
LRGTGNIPLLFLASAIAGSGIAVSNVLLSGLVKRDFAGQAALMMGLYTMAVCGGAASAAG
LTVPLEHALGGGWPYALAMWAAPALLVTLIWAPQALPLKPVASESGFTVRGLWRDRLAWQ
VTFFMGLQSALAYIVMGWLAPILRERGLGSETAGYVVSLSVMTQVVTCLVVPAVAVKLRN
QRGLAVVLAALTVAAMLAMLFAPLGGVWLWAVLLGIAQGGTFALALTMIVLRSPDSHVAA
HLSGMAQGVGYVVAACGPLLAGLLHGWTGSFRSSSWLFIGLGIALVAAGIGAGRTLHVGA
VTVPRR