Protein Info for ABID97_RS07905 in Variovorax sp. OAS795

Annotation: peroxide stress protein YaaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF03883: H2O2_YaaD" amino acids 1 to 246 (246 residues), 281.6 bits, see alignment E=5.1e-88

Best Hits

Swiss-Prot: 95% identical to Y1301_VARPS: UPF0246 protein Vapar_1301 (Vapar_1301) from Variovorax paradoxus (strain S110)

KEGG orthology group: K09861, hypothetical protein (inferred from 95% identity to vap:Vapar_1301)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>ABID97_RS07905 peroxide stress protein YaaA (Variovorax sp. OAS795)
MLFLLSPAKSLDYDTPVPAEIPATQPHFESPRGPSVELIKLLREKSPQQISELMHLSDKL
SALNVARYHAWAGKSTPKNARQAAFAFDGDVYGGLDARSLTPAQLAWAQEHVCILSGLYG
LLRPLDLLQPYRLEMGTPLANRHGKDLYAFWGSRIAAHLNERLAADRTPVVVNVASQEYF
RSVDRKALKARVVECVFEEWKGDRYKIVSFYAKRARGLLARWAVLHKAATPKALEKFDLE
GYGFDSTASTAERLVFRRKT