Protein Info for ABID97_RS07625 in Variovorax sp. OAS795

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02847: cytochrome o ubiquinol oxidase subunit IV
  • amino acids 29 to 124 (96 residues), 112.5 bits, E=5.2e-37
• PF03626: COX4_pro
  • amino acids 36 to 108 (73 residues), 61.7 bits, E=3.5e-21

Best Hits

Swiss-Prot: 41% identical to CYOD_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Pseudomonas putida

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 90% identity to vap:Vapar_4049)

MetaCyc: 42% identical to cytochrome bo terminal oxidase subunit IV (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (135 amino acids)

>ABID97_RS07625 cytochrome o ubiquinol oxidase subunit IV (Variovorax sp. OAS795)
MSTAHTGTAAAHGHDAHDDHHDDGPVSHSTFKGYMTGFVLAVILTAIPFWLVMGKVLSST
HTTSLVILGFAAVQIVVHMIYFLHMDAKSESGWNMLALIFTIVLVVITLAGSLWVMYHMN
ANMMPMSVHDMKNMP