Protein Info for ABID97_RS07225 in Variovorax sp. OAS795

Annotation: sn-glycerol-3-phosphate ABC transporter permease UgpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 291 (206 residues), 50.8 bits, see alignment E=9.1e-18

Best Hits

Swiss-Prot: 60% identical to UGPA_YERPS: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 82% identity to aav:Aave_3651)

MetaCyc: 58% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABID97_RS07225 sn-glycerol-3-phosphate ABC transporter permease UgpA (Variovorax sp. OAS795)
MEKRVLFRSAWLPWLLIAPQMAVILVFFFWPASQAIWQSMQTEDAFGTSTAFVGLENFKT
LFDDPAYIESFKVTALFSVLVAGIGISISLLLAIFADRILRGSLFYKTFLIIPYAVAPAI
AGVLWVFMFSPSIGVVSYGLRKMGMDWNHLLNSNQALSLIVVAAIWKQISYNFLFFLAGL
QSIPKALIEAAAIDGAGPLRRFMTIQFPLLSPTTFFLLVINVVYAFFDTFAIVHATTEGG
PGRDTAILVYKVWHDGFRALDLGGSAAQSVVLMVIVVVLTVIQFRYVEKKVQY