Protein Info for ABID97_RS06970 in Variovorax sp. OAS795

Annotation: type II secretion system minor pseudopilin GspK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21687: T2SSK_1st
  • amino acids 134 to 226 (93 residues), 35.8 bits, E=1.1e-12
• PF03934: T2SSK
  • amino acids 231 to 291 (61 residues), 36.6 bits, E=4.8e-13

Best Hits

KEGG orthology group: K02460, general secretion pathway protein K (inferred from 89% identity to vap:Vapar_1077)

Predicted SEED Role

"General secretion pathway protein K"

Protein Sequence (340 amino acids)

>ABID97_RS06970 type II secretion system minor pseudopilin GspK (Variovorax sp. OAS795)
MTASHFNFSAHGRRPSTRRQSGAALLAAMLTVMLVATFAAAALWQQWRASEVEAAERGRV
QAAWILIGALDWSRLILREDALTGGPDHLAEPWAVPLAEARLASFLSAEKNVSSDNLEGL
PDAFLSGRIVDAQSKLNVLSLVDGNKPVPASVATFTKLFNILGLPASELSAMTAALVRTL
ATGTDAAGGGDAGAAPLMPQEVSQLVWLGLSPSTAAALEPYVTVLPIRTPLNINTASAEA
ISASLPSLSISDARRVVEKRTNAFFRQITDANAALPNNASGSQFNASQHSVSTQFFEVYG
KLRLDRTWVEERSLLQREGLTVKTIWRNRGAGMTDPPAKP