Protein Info for ABID97_RS06730 in Variovorax sp. OAS795

Annotation: zinc-dependent alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF08240: ADH_N" amino acids 25 to 142 (118 residues), 83 bits, see alignment E=1.7e-27 PF00107: ADH_zinc_N" amino acids 188 to 265 (78 residues), 46.4 bits, see alignment E=3.7e-16

Best Hits

Swiss-Prot: 41% identical to ADHB_BACSU: Uncharacterized zinc-type alcohol dehydrogenase-like protein AdhB (adhB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_3032)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ABID97_RS06730 zinc-dependent alcohol dehydrogenase (Variovorax sp. OAS795)
MLAMNYRGPYRIRAVHKVEPEIEHPGDAIVRVTRSCICGSDLHLYHGLVPDTRIGSTFGH
EFTGVVESVGSAVQHLKPGDHVLVPFNIFCGSCYFCQRELYGNCHATNPEATAVGGIYGY
SHTAGGYDGGQAEYVRVPMADVGPTVIPSGMDLDDAVLLTDALPTGYQAAEMGGIREGDT
VVIFGAGPVGIFAAKSAWLLGAGRVIVVDHVDYRLEFVRSYAQCEVIDFKHVGDMAIHIK
NMTDGLGADVCIDCVGCEAAGNFAQTLLGIKLKLQAGAATVLHWCINSVRKGGTVSIVGV
YGPTFNAVPIGNAVNKGLTLRMNQASVKRHLPRLIEHIQAGRLDPRRVITHRIDLRDVAD
AYHIFSSKLDNCIKTVLVPPGVAQEATTAAASH