Protein Info for ABID97_RS06705 in Variovorax sp. OAS795

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 85 to 103 (19 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 13 to 213 (201 residues), 36.5 bits, see alignment E=1.3e-12 PF12146: Hydrolase_4" amino acids 26 to 122 (97 residues), 27.5 bits, see alignment E=2.9e-10 PF00326: Peptidase_S9" amino acids 57 to 224 (168 residues), 43.6 bits, see alignment E=4e-15

Best Hits

KEGG orthology group: None (inferred from 43% identity to vpe:Varpa_3037)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>ABID97_RS06705 alpha/beta fold hydrolase (Variovorax sp. OAS795)
MPNNARKGQKPAVLLASGWDDCDDPSYDRICEALAAEDWSVRRIDFPGERKRRGSRRKMN
RDQNLKELVAAYDSLVEREDFQPRAVAFIGFSYGGYLGALLSAQRPLQWMALRSPALYRD
EDWRVPKEALDKDDLDHYRRRVRGPEDNAALAACETFGGDVLLVESEHDDTVPHPAVKSY
RTSFKNARSLSYRVLEGADHALSSEQAQRRFVDELLRWMNEVTGGDA