Protein Info for ABID97_RS06515 in Variovorax sp. OAS795

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 15 to 204 (190 residues), 93.9 bits, E=1.9e-30
• PF08659: KR
  • amino acids 15 to 136 (122 residues), 33.4 bits, E=8.4e-12
• PF01370: Epimerase
  • amino acids 16 to 135 (120 residues), 24.5 bits, E=3.3e-09
• PF13561: adh_short_C2
  • amino acids 21 to 251 (231 residues), 109.6 bits, E=3.9e-35

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0976)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate transformations II (plants) (8/11 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

Protein Sequence (262 amino acids)

>ABID97_RS06515 SDR family oxidoreductase (Variovorax sp. OAS795)
MSTAPLPPVTPVRRTVLVTGAGRRLGREIALALAAGGWQVAVHYRSSQAEAEQTSAECAV
LSGHGSAVFEADLLDEGATRALLPRVAAHFGSVDAVVHSAALFEHDDAASFSYALMERHA
RSNTGAAILLAQALRDHLALRDAQGAVVHLLDQKLWNPNPDFLSYTLSKAALEAATPMLA
MALAPRVRVVGVAPGLTLPSHMLDDARFSQLHKLSPLGRSSTPADVAATVKFALENNSIT
GTTLLVDGGQHLMKFDRDFSLM