Protein Info for ABID97_RS06470 in Variovorax sp. OAS795

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 183 to 202 (20 residues), see Phobius details PF00512: HisKA" amino acids 253 to 314 (62 residues), 41.9 bits, see alignment E=8.6e-15 PF02518: HATPase_c" amino acids 365 to 474 (110 residues), 90.7 bits, see alignment E=8.9e-30

Best Hits

KEGG orthology group: K07711, two-component system, NtrC family, sensor histidine kinase YfhK [EC: 2.7.13.3] (inferred from 93% identity to vap:Vapar_0967)

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>ABID97_RS06470 ATP-binding protein (Variovorax sp. OAS795)
MAKRSSTRGSFQQLLLFAFLLITALLVGVALRSVFQYDALMTQSRDAAARALRLSGAAQS
LAERSAAMERAGRQSLVLNDAVLRRRFDDAAREAHGVLERLERNGLAPTGIEMWRSQLGL
IEGLMSGSPDTALSRENSMAIQFRDLDSLNTNIAQQAQFLIEMQNDALAKRIENARRRLM
REVVAASVLAVSLALAFGIWLARPFKRLEHAIVGLGQNRLDEPIDIRGPADVRRLSQQLE
WLRLRLTELDADKARFLRHVSHELKTPLAALREGVSLLEDGVTGPLNPAQLEVAQILNQN
TVSLQSQIEALLRFNAAAFEARELRRERTELLPLIEEQIEAQRLQWQAHGLRVRAEGEPL
ALTVDRVKLGTAVANLLSNAIRYSAPGGVITLTVSSTPDTACIDVNDAGPGIAEGDRDRI
FEPFYRGERQPEHAVKGTGIGLSIVQEYIAAHGGRITLQPGGPGARFRIELPRTA