Protein Info for ABID97_RS06210 in Variovorax sp. OAS795

Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF01225: Mur_ligase" amino acids 23 to 66 (44 residues), 21.3 bits, see alignment 4.3e-08 PF08245: Mur_ligase_M" amino acids 108 to 334 (227 residues), 139.2 bits, see alignment E=2.7e-44 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 151 to 511 (361 residues), 352.7 bits, see alignment E=1.7e-109 PF02875: Mur_ligase_C" amino acids 355 to 445 (91 residues), 81.1 bits, see alignment E=8.9e-27

Best Hits

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 90% identity to vap:Vapar_0914)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>ABID97_RS06210 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase (Variovorax sp. OAS795)
MLTLTSPQLAALWLKERVRGALHADSRPVGAGDGFIAWPGAATDGRKHVTAALAQGAAAC
LVEHDGVEAFGFQGDDRIASYPGLKAATGPIASAFYDNPSAALELLAVTGTNGKTSTAWW
LAESLSTLAVPGGVRALRPDGSTERGVPSPCAVMGTLGIGVPPELSYTGLTTPDPVMMQR
ELRSLVERGFGACAIEASSIGIAERRLDGARIAVAVFTNFTQDHLDYHGSMEAYWKAKAE
LFRWPGLRAAVINIDDVHGASLCANLVEGGIGALDVWTVSAAGSPARLMARDIGYGVEGL
QFSIAEHGTPSVERISTGLIGQYNVANLLGVLGTLRALGLSLAEAVAACASLTSVPGRME
RVGASANAPLAVVDYAHTPDALDKALAGLRPLARQRGGALWCLFGCGGDRDPIKRPMMAA
VAERQADRVIVTSDNPRSENPDAIISQVLLGLSRPEAAQVQPDRGTAIADAIAQAASEDV
VLIAGKGHEAWQEIAGQRIPFSDRTHALEALAKRGGHA