Protein Info for ABID97_RS05900 in Variovorax sp. OAS795

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00378: ECH_1" amino acids 8 to 252 (245 residues), 168.1 bits, see alignment E=2.4e-53 PF16113: ECH_2" amino acids 13 to 192 (180 residues), 87.6 bits, see alignment E=1.2e-28

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 96% identity to vap:Vapar_0820)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ABID97_RS05900 enoyl-CoA hydratase (Variovorax sp. OAS795)
MTDILAHTEAGVMTLTFNRVDKKNSITSKMYGEMADALASAESDAAVRCVLIQGDPTIFS
AGNDIGDFLNAPPAGQDSPVFRFLRGIATFPKPIVAAVCGPAVGIGTTMLFHCDLVYAGD
NAAFSMPFVNLGLCPEAASSLLVPQMLGYHRAAEALLLGEPFMAEAALEVGLVNRIVPPT
EANAIAQGQARKLAAKPLSALVETKRLLKKAQMPAVLERMGEEGASFGRMLREPAAREAF
GAFMEKRKPDFSKV