Protein Info for ABID97_RS05405 in Variovorax sp. OAS795

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 146 to 184 (39 residues), 37.3 bits, see alignment 3.3e-13 PF00924: MS_channel_2nd" amino acids 185 to 252 (68 residues), 67 bits, see alignment E=1.9e-22 PF21082: MS_channel_3rd" amino acids 259 to 342 (84 residues), 39.6 bits, see alignment E=8.5e-14

Best Hits

KEGG orthology group: None (inferred from 83% identity to vap:Vapar_0691)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>ABID97_RS05405 mechanosensitive ion channel family protein (Variovorax sp. OAS795)
MNQTIATLSDATLLGLPATDLALAIAAALAAYLAMRLVLRYVIERMRKIAAHTGNRIDDT
VVDVLGSTNRVFLLLAALLVGVGLLDLSERWNQRVGQLWFIALALQTGLWLTKAISLGLR
RYEARHTSAGMTQVSASAVLLSWSLRTLLWAVVLLAVLSNMGVNITAFVASLGVGGVAIA
LAVQNILGDLFASLAIAVDKPFEVGDAIGIGDLSGTVEHIGLKTTRLRSLTGEQIVISNT
DLLKQVVKNYRRMNERRIAFKFGMSYRSAPEKLEAIPGIVKRLIESRPSLRLDRVHFQAF
GQSSLDFEVVYFVKSADYGLYMDEQQRLNLQMMREFESLGVELAIPTQALYVAPTEGRRA
VARELATQD