Protein Info for ABID97_RS04970 in Variovorax sp. OAS795

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details PF00672: HAMP" amino acids 172 to 222 (51 residues), 29.1 bits, see alignment 2e-10 PF00512: HisKA" amino acids 252 to 317 (66 residues), 46.9 bits, see alignment E=4.5e-16 PF02518: HATPase_c" amino acids 362 to 472 (111 residues), 75.8 bits, see alignment E=7.5e-25 PF00072: Response_reg" amino acids 501 to 617 (117 residues), 51.2 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0510)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (636 amino acids)

>ABID97_RS04970 hybrid sensor histidine kinase/response regulator (Variovorax sp. OAS795)
MNWNFHVLRGLARLTFAQQLILLALVPATAATLAAIAVLTRQHLDNLTELMRANAQTVAL
QVATAAQAPLVRMDRRILQRTAQSGTYQPHVQQVQIWSDEGEIVANSETVDRARGEGLQV
VVPIVGDDGKHNGKVMVEMSLDAVQDARRSVWLNVVLVLAISLVGVGLAGWWAARRISEP
IRALGKAVDRLGAGEAASVEIEGTSEVRHLQHGFNQAARALAESHRLLQSRISEATAELA
RKNQQLEVASQAKTRLLAAASHDLRQPLHALTLFSDGLANGETDPVRLQRIGHIRECVDS
LDRLFSELLNLSQLDAGVLQPQWVDFPLDQLFDEISRNFRPVAEQQGLRLVARKTDLWVR
CDYVMLSRILNNLVSNSLRHTIEGGVLIGARRRGRGVRIDVVDTGVGIALQHQARVFEEF
YQVEGTGRQAPRGQRGMGLGLATVQRLADLLNTRVELTSRPQRGTCVRVLVRSAPAALPA
PDAAPAVGAVEEDASLDQLRILVIDDERTILEGLTVVLTHWGAEVMAAQTRAEALALADT
WTQPPDVVVSDLLLQGGDNGLDVIAALERHPRGIGAGTARLLVTGETKPDRLREVASAGI
TVLYKPVSPRVLRQAIQAQRASALLNAEAQALVHRT