Protein Info for ABID97_RS04755 in Variovorax sp. OAS795

Annotation: arginine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 536 to 555 (20 residues), see Phobius details TIGR00456: arginine--tRNA ligase" amino acids 5 to 561 (557 residues), 393.5 bits, see alignment E=6.8e-122 PF03485: Arg_tRNA_synt_N" amino acids 7 to 92 (86 residues), 66.9 bits, see alignment E=4.9e-22 PF00750: tRNA-synt_1d" amino acids 104 to 409 (306 residues), 69.6 bits, see alignment E=6.4e-23 PF05746: DALR_1" amino acids 444 to 561 (118 residues), 112.6 bits, see alignment E=2.9e-36

Best Hits

Swiss-Prot: 80% identical to SYR_RHOFT: Arginine--tRNA ligase (argS) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 96% identity to vap:Vapar_0461)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>ABID97_RS04755 arginine--tRNA ligase (Variovorax sp. OAS795)
MLLVKQELLAALANTLESLSPGAGSKAAFESPKVAAHGDFASTAAMQLAKPLGRKPRELA
EALSAALLATPVFGQWVEAIEIAGPGFLNIRLKTSAKQQIVREVLDAAGSFGRQPATGEK
VLVEFVSANPTGPLHVGHGRQAALGDAICNLRASQGDTVWREFYYNDAGVQIQTLANSTQ
LRARGFKPGDPEWPSGEKAPAYNGDYIADIAEDFKARKTVRSDDREYTASGDIDDLDSIR
EFAVAYLRREQDLDLQAFRVRFDNYYLESSLYTSGRVEAAVQKLVAAGKTYEQDGALWLR
STDYGDDKDRVMKKQDGTYTYFVPDVAYHIAKWERGFHKVVNIQGTDHHGTIARVRAGLQ
AAGVGIPAGYPDYVLHTMVRVMKGGEEVKISKRAGSYVTLRDLIEWTSTDAVRFFLLSRK
PDTEYTFDVDLAVAKNNDNPVYYVQYAHARICSVLAGWGGEAATLKNVDLSPLESPAAQA
LMLLLAKYPAMLTAAAKDFAPHDVTFYLRELAASYHSYYDAERILVDEEPVKLARLALVA
ATAQVLHNGLAILGVSAPSKM